Jurnal Internasional Bagaimana saya menggunakan tes genetik molekuler untuk mengevaluasi pasien yang memiliki atau mungkin memiliki sindrom myelodysplastic

Download Jurnal Disini

Abstrak

Myelodysplastic syndromes (MDS) dapat sulit didiagnosis, terutama ketika perubahan morfologi dalam darah dan sel sumsum minimal, proporsi myeloblast tidak meningkat, dan kariotipe normal. Penemuan> 40 gen yang berulang kali bermutasi secara somatik pada pasien MDS meningkatkan harapan bahwa pengujian genetika molekuler untuk mutasi ini mungkin membantu memperjelas diagnosis pada kasus ambigu dimana pasien datang dengan temuan mukosa sitopenia dan nondiagnostik sumsum tulang. Namun, banyak individu sehat yang lebih tua juga memiliki mutasi somatik pada gen driver terkait leukemia, terutama di DNMT3ATET2dan ASXL1dan deteksi penuaan umum- mutasi terkait pada pasien cytopenic dapat menyebabkan ketidakpastian diagnostik. Meskipun faktor pembaur potensial ini, pola mutasi somatik tertentu ketika diamati pada pasien cytopenic memberi kemungkinan tinggi perkembangan penyakit dan memungkinkan diagnosis sementara MDS bahkan jika displasia morfologis dan kriteria diagnostik lainnya tidak ada. Subset mutasi didapat juga mempengaruhi stratifikasi risiko pasien dengan diagnosis MDS yang ditetapkan dan dapat menginformasikan pemilihan pengobatan. Banyak pertanyaan yang tidak terjawab tentang implikasi mutasi spesifik, dan dokter juga sangat bervariasi dalam kenyamanan mereka dengan menginterpretasikan hasil sekuensing. Di sini, saya meninjau penggunaan tes genetik molekuler pada pasien dengan kemungkinan MDS atau MDS yang didiagnosis.

Pendahuluan

Sejak klasifikasi formal pertama sindrom myelodysplastic (MDS) oleh kelompok kerja Perancis-Amerika-Inggris pada tahun 1976 dan 1982 , MDS telah didefinisikan oleh adanya sitopenia darah persisten (s) terkait dengan perubahan morfologi karakteristik tertentu dalam darah dan sel sumsum. 1 Pencarian untuk perubahan morfologi sel hematopoietik “displastik” ini masih penting dalam evaluasi diagnostik dari pasien dengan cytopenia yang tidak dapat dijelaskan. 2 Perubahan displastik MDS terkait dalam garis keturunan erythroid termasuk pematangan eritroid megaloblastoid, prekursor eritroid multinucleated, karyorrhexis, dan sideroblas cincin; dalam garis keturunan granulocytic, mereka termasuk neutrofil hypogranular atau hypolobated (pseudo-Pelger-Hüet); dan dalam garis keturunan megakaryocyte, hypolobated, hypersegmented, atau micromegakaryocytes. 3

Sayangnya, tak satu pun dari temuan morfologis ini spesifik untuk MDS. Cytopenias dan displasia morfologis juga dapat disebabkan oleh berbagai “MDS mimik” yang mungkin disalahartikan sebagai MDS atau dapat berdampingan dengan MDS, seperti defisiensi nutrisi, infeksi virus, obat-obatan, atau sindrom kegagalan sumsum bawaan atau didapat. 4 [19659006] Oleh karena itu, untuk mendiagnosis MDS, klasifikasi Organisasi Kesehatan Dunia (WHO) 2016 saat ini terus mensyaratkan setidaknya menemukan 10% sel displastik dalam setidaknya 1 garis hematopoietik, kariotipe abnormal (eksklusif temuan nonspesifik tertentu seperti hilangnya Y kromosom), atau peningkatan mieloblas (5% hingga 19%, dengan ≥20% didefinisikan sebagai leukemia mieloid akut [AML]). 5 Alternatif kriteria diagnostik minimal untuk MDS baru-baru ini diusulkan oleh kerja internasional kelompok (Tabel 1). 6

Tabel 1.

Mengusulkan kriteria diagnostik minimal untuk MDS

Selain itu, displasia sampai batas tertentu subjektif, dan ada derajat tinggi dari variabilitas antarobserver dalam penilaian displasia di antara morfolog. 710 Banyak orang sehat yang berusia di atas 50 tahun dengan jumlah darah normal mengalami perubahan displastik kecil pada sumsum tulang belakang. aspirate. 11 Sebagai hasil dari subjektivitas dan kurangnya spesifisitas morfologi displastik, tes diagnostik yang lebih baik untuk mengevaluasi kemungkinan MDS pada pasien cytopenic diperlukan. 1012

Dalam 10 tahun terakhir,> 40 mutasi gen rekuren yang berbeda telah dikaitkan dengan MDS, termasuk perubahan dalam faktor pengkodean gen yang penting untuk splicing RNA messenger, pola epigenetik dan remodeling kromatin, perbaikan DNA, transduksi sinyal, faktor transkripsi, dan [cohesins1314 Meskipun tidak ada mutasi tunggal yang terdeteksi pada lebih dari 25% hingga 30% pasien, secara kolektif hampir semua pasien dengan MDS yang ditentukan oleh kriteria WHO akan dapat ditemukan. Setidaknya satu dari mutasi somatik ini terdeteksi.

Next sequencing sequencing (NGS) menguji bahwa tes untuk subset dari mutasi gen MDS terkait pada tingkat DNA sekarang tersedia secara luas dalam praktek klinis dan sering digunakan dalam evaluasi diagnostik. 1516 Sebagai komunitas hematologi, bagaimanapun, kita masih belajar cara terbaik untuk menggunakan tes ini, baik untuk evaluasi pasien dengan cytopenia yang mungkin memiliki MDS dan pada pasien dengan MDS didirikan. Ada variabilitas yang cukup besar dalam penggunaan dan interpretasi panel semacam itu di antara hematologis. 1517

Di bawah ini, saya menggambarkan 4 pasien saya yang menggambarkan beberapa manfaat dan tantangan potensial yang terkait dengan penggunaan tes genetik molekuler dalam praktek klinis.

Pasien 1

Seorang wanita 72 tahun ditemukan mengalami anemia makrositik (hemoglobin [Hb] 10,9 g / dL, volume sel rata [MCV] 101 fL) dan trombositopenia ringan (jumlah trombosit 135 × 10 9 / L) setelah dia melihat dokter perawatan primer baru dan menyebutkan peningkatan kelelahan. Jumlah sel darah putih (WBC) dan jumlah neutrofil mutlak dalam batas normal, dan hapusan darah tidak menunjukkan leukosit abnormal. Dia tidak memiliki jumlah darah dalam beberapa tahun, tetapi jumlah sebelumnya dia semua biasa-biasa saja. Tidak ada penjelasan yang jelas untuk cytopeniasnya berdasarkan obatnya (hanya lisinopril dan sertraline) atau studi laboratorium dasar, termasuk serum kimia, vitamin B 12 dan kadar folat sel darah merah, dan elektroforesis protein serum. [19659037MeskipundiusulkankepadapasienbahwadiadapatdiamatidenganjumlahdarahserialyangdiberikancytopeniayangrelatifringandiacukupkhawatirtentangpotensidiagnosadandokterperawatanprimernyajugamemintaaspirasisumsumdanbiopsidilakukanMorfologisumsumtulangtidaknondiagnostik:30%seluler(normoseluleruntukusia)denganhanyamegakariositdysplasticlangkayangmewakili<10%seldalamgarisketurunantersebutTidakadalokalisasiabnormalprekursorbelummatangpeningkatanfibrosisreticulinataupolaimunohistokimiamenyimpangFlowcytometrydilaporkansebagaibiasa-biasasaja("terlalusedikitledakanuntukenumerasi")dankariotipeadalahmetafasewanitanormaldalam20metafase

Sebuah panel NGS 95-gen 18 dengan cakupan amplikon rata-rata> 1000 × menunjukkan tidak ada varian tunggal nukleotida patogen atau insersi / delesi kecil, dan analisis jumlah pembacaan menunjukkan tidak ada perubahan jumlah salinan. Pasien diberitahu bahwa dia menderita ICUS, dan observasi kembali direkomendasikan.

Diskusi: pasien 1

Panel NGS dapat berguna untuk membantu menyingkirkan gangguan klonal karena mereka memiliki nilai prediktif negatif yang relatif tinggi untuk MDS. Dalam seri yang baru-baru ini dilaporkan, mutasi terdeteksi pada 74% hingga 91% pasien dengan MDS yang ditetapkan WHO, menggunakan panel gen yang mencakup 17 hingga 111 gen yang terkait dengan neoplasma hematologi. 131920 Carl Sagan, astronom terkenal dan popularizer sains (yang meninggal pada tahun 1996 dari komplikasi MDS dan transplantasi sel hematopoietik alogenik), gemar mengatakan, “Ketiadaan bukti bukanlah bukti ketidakhadiran, ”Dan sebagian kecil pasien dengan MDS akan memiliki hasil negatif pada panel NGS. Namun, temuan hasil negatif pada panel yang dirancang dengan baik dalam kasus yang ambigu seperti ini harus meminta pertimbangan diagnosis alternatif

Pada waktunya, diagnosis spesifik, konsumsi alkohol berlebihan, menjadi jelas pada pasien 1, yang mengalami kesedihan patologis setelah kehilangan suaminya. Setelah pasien diberikan dukungan psikososial yang sesuai dan penghentian penggunaan alkohol, jumlah darahnya kembali normal.

Tentu dapat dikatakan bahwa pasien seperti wanita ini dapat diikuti secara bertahap dari waktu ke waktu, menghemat biaya panel NGS (dan dari biopsi sumsum). Namun, terutama untuk pasien dengan> 1 sitopenia, sering ada kekhawatiran yang cukup besar tentang gangguan klonal yang berkembang, yang mungkin hidup berdampingan dengan penyebab potensial lain dari cytopenias, termasuk penggunaan alkohol. Ketika panel NGS digunakan, mereka harus ditafsirkan dalam konteks informasi yang diperoleh dari morfologi dan pengujian sitogenetika konvensional. Karena panel NGS menjadi lebih murah, nampaknya mereka akan bergerak lebih awal dalam algoritma pengujian diagnostik untuk pasien dengan cytopenia.

Pasien 2

Seorang pria berusia 67 tahun dirujuk ke pusat kami setelah dia ditemukan mengalami anemia makrositik (Hb 11,2 g / dL, MCV 100 fL), yang bertahan selama 9 bulan, dan yang sedikit lebih buruk (Hb 10.6 g / dL) pada saat evaluasi awal di pusat rujukan. Jumlah dan diferensial WBC-nya biasa-biasa saja, dan jumlah trombositnya berada di ujung bawah kisaran normal (188 × 10 9 / L). Jumlah darah sebelumnya telah normal kecuali untuk anemia normositik ringan yang tercatat pada saat pneumonia bakteri 3 tahun sebelumnya, yang akhirnya teratasi. Tidak ada obat-obatan atau kondisi komorbid yang dirasakan mungkin berkontribusi pada cytopenias-nya, dan dia tidak minum alkohol. Kelompok serum kimia, tingkat vitamin B 12dan kadar folat sel darah merah semuanya normal.

Pasien adalah dokter dengan paparan fluoroskopi sebelumnya yang meningkatkan kekhawatiran akan MDS terkait paparan, dan oleh karena itu, ia telah menjalani aspirasi sumsum tulang dan biopsi di bawah perawatan ahli onkologi hematologi setempat. Ini adalah sel sumsum 40% dengan megaloblastoid langka atau sel erythroid binukleat yang mewakili <10% prekursor erythroid berinti. Flow cytometry tidak biasa-biasa saja, dan kariotipe adalah metafase pria normal di semua 20 metafora yang diuji. Namun, panel genetik molekuler menunjukkan mutasi DNMT3A R882H dengan 14,6% varian frekuensi alel (VAF). Pasien khawatir bahwa ia berevolusi MDS.

Diskusi: pasien 2

Mutasi somatik pada gen driver terkait leukemia diamati pada> 10% orang yang lebih tua dari usia 60 tahun. 2123 Hematopoiesis klonal tidak terkait dengan mutasi gen driver leukemia yang diakui, karena baik mutasi driver yang tidak diketahui atau pergeseran klonal terkait usia yang netral, bahkan lebih sering terjadi pada penuaan. Ketika 1 dari mutasi driver diketahui hadir pada VAF> 2%, ekspansi klonal yang terkait telah disebut hematopoiesis klonal dari potensi tak tentu (“CHIP”) dan menganugerahkan 0,5% hingga 1,0% risiko perkembangan menjadi MDS yang ditentukan oleh WHO. , AML, atau neoplasma hematologi lainnya. 2425 CHIP juga dikaitkan dengan peningkatan risiko kejadian kardiovaskular dan mortalitas. 26 Mayoritas pasien dengan CHIP memiliki satu titik mutasi di DNMT3ATET2atau ASXL1 di VAF <20%, kemungkinan besar dihasilkan dari transisi cytidine-ke-timidin dari kesalahan peristiwa deaminasi spontan. Mutasi ini dapat dideteksi pada pasien dengan jumlah darah normal yang tampak sehat satu dekade atau lebih sebelum diagnosis AML, dan pola mutasi tertentu memprediksi risiko pengembangan AML yang lebih tinggi. 2728 [19659061KetikaterjadimutasipadapasienyanglebihtuadengansitopeniaterutamamutasiyangumumnyaterkaitdenganCHIPkemungkinantimbulbahwamutasidansitopeniamungkintidakberhubungan29 Namun, seri Eropa baru-baru ini mengklarifikasi bahwa pada pasien dengan cytopenia persisten yang tidak dapat dijelaskan, mutasi pada gen penggerak leukemia yang terkait memberikan risiko substansial terhadap pengembangan MDS atau AML yang didefinisikan WHO, dengan rasio hazard> 13,9 kali lipat lebih tinggi daripada risiko pengembangan MDS / AML pada pasien dengan ICUS tanpa mutasi klonal. 30 Risiko pengembangan untuk pasien dengan “clonal cytopenias dengan signifikansi tak tentu” (CCUS) adalah terbesar bagi mereka dengan beban mutasi yang lebih tinggi (VAF> 20%), > 1 mutasi, atau mutasi pada faktor splicing. Di antara pasien dengan CCUS, kemungkinan kumulatif evolusi ke MDS / AML pada 4 tahun adalah> 70%, dibandingkan dengan <10% untuk pasien ICUS yang tidak termutasi. Di masa depan, ada kemungkinan bahwa pasien dengan pola mutasi tertentu mungkin dapat didiagnosis sebagai "MDS tanpa displasia," mengingat harapan hidup yang singkat ini dan riwayat alam yang mirip dengan yang diamati dengan MDS didiagnosis menggunakan kriteria WHO saat ini.31

Dihadapkan dengan diagnosis CCUS dan kemungkinan yang relatif tinggi dari evolusi selanjutnya dari MDS atau AML yang didefinisikan oleh WHO, pasien 2 pensiun dari praktik medisnya dan mengambil serangkaian perjalanan internasional yang selalu diinginkannya tetapi tidak pernah dapat menemukan waktu karena pekerjaannya yang menguras tenaga. Dua tahun setelah evaluasi awal, ia mengembangkan pansitopenia dan ditemukan mengalami peningkatan ledakan, dan diagnosis MDS dengan kelebihan ledakan tipe 2 dibuat menggunakan kriteria WHO. Meskipun pengobatan dengan decitabine diikuti oleh transplantasi sel hematopoietik alogenik, MDS nya kambuh dan dia meninggal.

Pasien 3

Seorang wanita 64 tahun yang tidak memiliki hitung darah dalam> 5 tahun disajikan dengan pansitopenia (Hb) 9,7 g / dL, WBC 1,4 × 10 9 / L, trombosit 48 × 10 9 / L) dan menjalani aspirasi sumsum dan biopsi, yang konsisten dengan MDS dengan kelebihan ledakan tipe I Displasia multilinease hadir, termasuk 10% cincin sideroblas. Kariotipe menunjukkan monosomi 7 dalam metafora 6/20, penghapusan kromosom 20q dan hilangnya kromosom X dalam metafora 8/20, dan 6 metafora wanita normal. Pengujian mutasi menunjukkan SF3B1 K700E (26,8% VAF) dan TP53 V197M (16,0% VAF).

Diskusi: pasien 3

Pengujian molekuler pada pasien dengan diagnosis MDS yang mapan dapat memberikan informasi yang dapat mempengaruhi stratifikasi risiko dan dalam beberapa pemilihan pengobatan kasus. 3233 Misalnya, sebuah makalah tahun 2011 di New England Journal of Medicine melaporkan bahwa adanya mutasi pada TP53ETV6ASXL1EZH2atau RUNX1 secara efektif meningkatkan stratifikasi strateikasi Sistem Internasional Prognostik Internasional MDS pasien dengan 1 risiko 19 Selanjutnya, kegunaan genetika molekuler dalam penilaian prognostik MDS dikonfirmasi pada 1996 pasien dari 18 pusat yang dikumpulkan oleh Kelompok Kerja Internasional tentang Prognosis di MDS. 34 Di antara 17 gen yang diperiksa dalam model kelangsungan hidup multivariabel, mutasi di SF3B1 ditemukan untuk memberikan Revised International Prognostic Scoring System – prognostik informasi independen yang menguntungkan, sedangkan mutasi dalam 4 gen (TP53RUNX1EZH2NRAS) dikaitkan dengan hasil yang lebih buruk. Baru-baru ini, di antara 339 pasien dengan kariotipe kompleks (didefinisikan sebagai 3 atau lebih kelainan, sesuai Revised International Prognostic Scoring System) dievaluasi oleh Kelompok Kerja Internasional tentang Prognosis di MDS, 55% memiliki TP53 mutasi, dan Kehadiran TP53 mutasi adalah penentu yang lebih besar dari kelangsungan hidup keseluruhan yang lebih miskin daripada kariotipe monosomal atau kariotipe yang sangat kompleks (didefinisikan sebagai 5 atau lebih kelainan) (Detlef Haase, Kristen E. Stevenson, Donna Neuberg, Jaroslaw P. Maciejewski, Aziz Nazha, Mikkael A. Sekeres, Benjamin L. Ebert, Guillermo Garcia-Manero, Claudia Haferlach, Torsten Haferlach, Wolfgang Kern, Seishi Ogawa, Yasunobu Nagata, Kenichi Yoshida, Timotius A. Graubert, Matthew J. Walter , Daftar Alan F., Rami S. Komrokji, Eric Padron, David Sallman, Elli Papaemmanuil, Peter J. Campbell, Michael R. Savona, Adam Seegmiller, Lionel Adès, Pierre Fenaux, Lee-Yung Shih, David Bowen, Michael J. Groves, Sudhir Tauro, Michaela Fon tenay, Olivier Kosmider, Michal Bar-Natan Zommer, DPS, Richard Stone, Michael Heuser, Felicitas Thol, Mario Cazzola, Luca Malcovati, Aly Karsan, Christina Ganster, Eva Hellström-Lindberg, Jacqueline Boultwood, Andrea Pellagatti, Valeria Santini, Lynn Quek , Paresh Vyas, Heinz Tüchler, Peter L. Greenberg, dan Rafael Bejar untuk Kelompok Kerja Internasional untuk MDS Molecular Prognostic Committee, manuscript yang diserahkan Juni 2018).

Dengan pengecualian dari mutasi yang dapat ditargetkan yang langka, seperti mutasi IDH1 / IDH2 Obat-obatan yang disetujui oleh Food and Drug Administration tersedia (persetujuan pengaturan mereka saat ini untuk AML kambuh / refrakter, sehingga MDS adalah penggunaan off-label), hasil NGS memiliki pengaruh yang relatif kecil pada pemilihan obat di luar konteks uji klinis. Dalam beberapa seri, TET2 mutasi telah dikaitkan dengan kemungkinan respon yang lebih tinggi terhadap terapi agen hipomethylating, sedangkan ASXL1 mutasi dikaitkan dengan respon yang lebih rendah, 3536 tetapi seri lainnya telah melaporkan hasil yang lebih baik pada ASXL1- pasien yang mengalami mutasi yang diobati dengan azacitidine. 37 Data tidak konsisten, dan efek dari mutasi tersebut tidak kuat. Mengingat terbatasnya jumlah terapi yang tersedia untuk MDS, hasil ini tidak cukup untuk mempengaruhi pilihan terapi tertentu di luar konteks penelitian.

Namun, hasil NGS dapat membuat pasien memenuhi syarat untuk uji klinis. Sebagai contoh, TET2 pasien mutan sedang dirawat dengan vitamin C 38 ( NCT03433781 NCT03397173), dan ASXL1 pasien mutan mungkin kandidat yang baik untuk modulator bromodomain. 39 Penyambungan pasien mutasi mutan memenuhi syarat untuk uji coba dengan inhibitor SF3B1 H3B-8800 ( NCT02841540), 40 [19659006] dan TP53 mutan (tidak TP53 dihapus) pasien sedang dirawat pada studi dengan bahan penguat protein P53 APR-246 ( NCT03072043). 41 Selain itu, pada bulan Juni 2018 diumumkan bahwa uji coba acak MEDALIST yang dikontrol plasebo ( NCT02631070) dari luspatercept, suatu perangkap ligan reseptor aktivin, bertemu dengan titik akhir primer dari kemandirian transfusi, meningkatkan kemungkinan bahwa obat ini akan disetujui untuk indikasi terkait MDS pada 2019. Pasien memenuhi syarat untuk uji coba MEDALIST jika mereka memiliki MDS risiko rendah dengan ≥15% sideroblas cincin dalam sumsum, atau ≥5% cincin sideroblas (RS) plus mutasi SF3B1yang mencerminkan definisi MDS-RS di klasifikasi WHO tahun 2016.

Dalam seri 2-institusi, pasien dengan MDS risiko tinggi yang memiliki TP53 mutasi dan diobati dengan terapi dekitabin 10 hari memiliki respon lengkap atau sumsum lengkap lengkap 100% rate 42 Namun, TP53 mutan bagian dalam seri agen hipomethylating lainnya, seperti CALGB-11002 Alliance 10-hari studi kelompok kooperatif decitabine ( NCT01420926) , belum menikmati tingkat respons yang tinggi. Kehadiran TP53 mutasi merupakan faktor risiko untuk perkembangan awal pada pasien yang diobati dengan lenalidomide. 43

Dalam Pusat Analisis Darah dan Marrow Transplant Internasional analisis> 1500 pasien dengan MDS yang menjalani transplantasi sel hematopoietik alogenik menggunakan pengkondisi baik myeloablative atau mengurangi-intensitas, mereka dengan TP53 mutasi memiliki hasil yang jauh lebih miskin, dan JAK2 dan mutasi jalur Ras juga dikaitkan dengan jangka panjang yang lebih rendah. survival. 44 Meskipun kadang-kadang masih ada survivor jangka panjang dengan TP53 penyakit mutan yang telah menjalani transplantasi, sehingga pasien tersebut tidak boleh secara kategoris ditolak kemungkinan manfaat kuratif dari terapi definitif dengan transplantasi, pasien seperti itu idealnya harus menjalani transplantasi dalam konteks uji klinis untuk mencoba memperbaiki hasil yang buruk saat ini dengan genotipe ini.

Pasien 3 dimulai pada azacitidine sebagai jembatan untuk transplantasi dan mengalami remisi lengkap. Dia menjalani transplantasi alogenik pada protokol eksperimental dengan vaksin seluler posttransplant, tetapi meninggal karena komplikasi influenza B yang rumit oleh sepsis bakteri segera setelah transplantasi.

Pasien 4

Seorang pria berusia 72 tahun mencatat kuadran kuadran kiri atas sementara dia bersepeda. Sedang splenomegali terdeteksi pada pemeriksaan fisik dan dikonfirmasi dengan pencitraan tomografi dikomputasi, yang juga menunjukkan pembesaran hati dan beberapa kelenjar getah bening retroperitoneal yang juga membesar dalam kisaran 2 sampai 3 cm. Jumlah darahnya termasuk Hb 11,1 g / dL, MCV 93 fL, WBC 6,65 × 10 9 / L dengan monosit 31%, neutrofil 36%, dan 24% limfosit, dan jumlah trombosit 140 × 10 9 / L. Biopsi sumsum tulang adalah hiperkular untuk usia dengan displasia eritroid, peningkatan ringan pada fibrosis retikulin, dan peningkatan monosit tanpa peningkatan ledakan atau promonosit, konsisten dengan leukemia myelomonocytic kronis tipe 1 (CMML-1). Kariotipe normal, dan terfokus pada hibridisasi in situ MDS (FISH) juga belum terungkap. Pengujian gen tunggal untuk JAK2 adalah tipe liar. Biopsi kelenjar getah bening retroperitoneal menunjukkan fibrosis, yang ditafsirkan sebagai reaktif, dan biopsi hati yang membesar menunjukkan fibrosis fokal tidak teratur dan area penipisan portal. Evaluasi ekstensif untuk penyebab sirosis kriptogenik termasuk virus, toksik, dan etiologi kekebalan belum terungkap. Pasien mengembangkan ascites dan mulai membutuhkan serial paracentesis volume besar.

Pasien kemudian dirujuk ke pusat kami untuk menilai apakah fibrosis hepatiknya mungkin paraneoplastic sebagai konsekuensi dari CMML. Pengetikan molekuler darah menunjukkan ASXL1 G642fs * di 70,6% dari 119 urutan membaca, KIT D816V di 41,8% dari 593 bacaan, TET2 Q866 * di 45,4% dari 1442 bacaan, dan TET2 Y1255 * di 46,7% dari 302 bacaan. Setelah mencatat mutasi KIT, seorang ahli patologi yang meninjau sumsumnya meminta biopsi hati luar dan blok kelenjar getah bening untuk ditinjau, dan studi immunoperoxidase dari sampel ini mengungkapkan agregat kecil sel spindle di dalam fibrosis yang positif untuk tryptase sel mast dan C-Kit dan juga CD25 yang diekspresikan secara menyimpang. Tingkat serumtryptase pasien ditemukan> 500 ng / mL. Dia tidak memiliki gejala mediator sel mast. Dia kemudian diobati dengan protokol penggunaan penuh kasih dengan midostaurin 45 dan mengalami perbaikan klinis, termasuk eliminasi asites dan splenomegali dan pengurangan tryptase sebesar> 50%. Setelah ia menjadi resisten terhadap midostaurin, ia diobati dengan avipiritinib (BLU-295), juga oleh penggunaan belas kasih, dan mendapatkan kembali respon.

Diskusi: pasien 4

Kadang-kadang, panel NGS dapat mengungkap temuan tak terduga yang dapat mengungkapkan diagnosis tambahan atau diagnosis alternatif. Pada pasien 4 yang memiliki CMML, penemuan mutasi KIT D816 yang umumnya terkait dengan mastositosis sistemik (SM) menyebabkan studi tambahan, yang menegaskan diagnosis SM dengan penyakit hematologi terkait, dan memungkinkan pemilihan terapi yang ditargetkan yang meningkatkan gejala pasien.

Kemungkinan menemukan diagnosis tambahan tergantung pada komposisi panel pengurutan. Misalnya, untuk alasan logistik dan alur kerja, institusi kami menggunakan panel NGS tunggal dengan gen yang terkait dengan limfoid, sel plasma, dan gangguan myeloid. STAT3 mutasi berhubungan dengan leukemia limfosit granular besar (40% hingga 50% kasus 46), dan dalam setiap kasus di mana kita telah menemukan STAT3 mutasi, penelitian berikutnya, termasuk penataan ulang gen reseptor sel T, menunjukkan leukemia limfosit granular besar. 47

Sebaliknya, pasien yang sedang dievaluasi untuk neoplasma sel plasma atau gangguan limfoproliferatif dapat ditemukan memiliki mutasi CHIP-terkait, yang dapat mempersulit evaluasi karena mutasi ini juga sering dikaitkan dengan neoplasma myeloid. Dengan demikian, mungkin ada ketidakpastian tentang apakah ada MDS bersamaan atau neoplasma myeloid lain yang disamarkan oleh limfoid atau gangguan sel plasma, dan ketidakpastian ini dapat mempengaruhi kelayakan untuk protokol pengobatan mieloma atau limfoma.

Pasien 4 diuji dengan “ Panel IKAN MDS ”meskipun kariotipnya telah menunjukkan 20 metafora normal. IKAN menambahkan sangat sedikit dalam kasus-kasus yang dicurigai neoplasma myeloid di mana setidaknya 20 metafora dapat dinilai dengan kariotyping konvensional. Sebagai contoh, dalam penelitian Mayo Clinic di mana 505 kasus dengan kemungkinan MDS dinilai oleh kedua kariotyping dan IKAN, konkordansi antara kariotyping dan IKAN adalah 96% dalam kasus di mana cytogeneticists dapat menghitung setidaknya 20 metafase. 48 sejumlah kecil pasien dalam seri Mayo di antaranya kelainan tambahan ditemukan oleh IKAN yang tidak diamati pada kariotyping (kebanyakan mereka dengan <20 metafase), tidak ada dampak dari hasil IKAN pada diagnosis atau terapi, dan hanya 6 pasien memiliki perubahan dalam MDS cytogenetic risk scoring sebagai hasil dari anomali yang terdeteksi oleh IKAN. Para penulis menyimpulkan bahwa pengujian panel IKAN hanya harus dipertimbangkan jika <20 metafora diperiksa. Tentu saja, kadang-kadang pada saat pengambilan sampel sumsum, belum diketahui apakah 20 metafora akan dapat dikototipkan, sehingga beberapa dokter melakukan perintah sumsum, baik karyotyping dan IKAN untuk memastikan. Namun, hal ini tidak diperlukan dalam sebagian besar kasus.

Peringatan

Ketika menginterpretasikan hasil NGS atau mempertimbangkan untuk mendapatkan pengetikan molekuler pada pasien dengan MDS atau MDS yang mungkin, perhatian ditunjukkan. Dalam sebagian besar publikasi hingga saat ini, mutasi telah diperlakukan sebagai variabel biner: wild type vs mutan, tetapi banyak gen terkait MDS memiliki derajat heterogenitas alel yang tinggi, dan alel spesifik dapat mempengaruhi fenotipe atau perilaku klinis. Selain itu, mutasi sering dianggap dalam isolasi, tetapi kombinasi mutasi yang bekerja sama dapat mempengaruhi hasil berbeda dari mutasi tunggal, dan mutasi perlu ditafsirkan dalam konteks data klinis dan patologis lainnya. Mengingat kekuatan kombinatorial> 40 gen MDS terkait berbeda dengan heterogenitas alelik, maka akan diperlukan serangkaian besar pasien untuk memperjelas interaksi ini.

Selain itu, banyak varian nukleotida tunggal yang diamati dalam tes NGS memiliki signifikansi yang tidak jelas. Meskipun tersedia standar dan pedoman, implementasi lokal aturan untuk menyatakan varian sebagai patogen vs signifikansi yang tidak diketahui mungkin berbeda antara laboratorium. 49 American Society of Hematology telah mengadakan gugus tugas untuk merekomendasikan aturan untuk pemanggilan varian dalam NGS tes untuk gangguan hematologi. Interpretasi varian kemungkinan akan menjadi lebih menantang karena panel NGS yang ditargetkan semakin memberi jalan menuju pendekatan sekuensing keseluruhan eksome atau keseluruhan-genome dan karena data dari RNA berskala besar, protein, dan uji epigenetik lebih banyak tersedia.

Penting Beberapa varian yang diamati pada panel NGS adalah germline daripada somatik, terutama mereka yang memiliki VAF dekat 50%, dan pada gen seperti TP53 atau RUNX1 di mana mutasi yang diwariskan dapat mempengaruhi neoplasia myeloid. . Perbedaan somatik vs germline adalah penting untuk sejumlah alasan, termasuk pemilihan donor transplantasi alogenik, pemantauan pasien untuk komplikasi non-hematologi (misalnya, kanker epitel pada sindrom Li-Fraumeni), dan konseling keluarga. 50 [19659006] Kultur fibroblast atau sumber sel non-hematopoietik lain yang bebas dari kontaminasi darah mungkin diperlukan untuk membedakan antara germline dan varian somatik.

Beberapa varian yang terdeteksi selama evaluasi pasien dengan dugaan MDS mungkin tidak berada dalam sel myeloid. Sebagai contoh, adalah umum untuk pasien yang lebih tua untuk memiliki limfositosis sel B monoklonal. Jika ada populasi klon sel-B bersamaan dan sel-sel mieloid displastik, varian SF3B1 yang terdeteksi dapat hadir dalam klon sel-B atau di MDS, dan hanya tes mutasi sel-sel yang disortir garis keturunan, yang biasanya tidak tersedia secara klinis, dapat menentukan ini dengan pasti.

Meskipun biaya aktual untuk melakukan pengujian molekuler sekarang relatif murah, tes NGS klinis di laboratorium komersial dan laboratorium institusi akademik sering memiliki markup penagihan yang besar dan dapat menambah biaya besar untuk evaluasi pasien. . 51 Penghapusan pengujian panel IKAN yang tidak perlu dapat membantu mengurangi biaya evaluasi diagnostik, tetapi dokter perlu hati-hati mempertimbangkan apakah informasi yang akan diperoleh bernilai biaya panel genetik molekuler atau apakah pasien dapat bukan hanya diikuti seiring waktu dengan jumlah darah serial, seperti yang bisa dilakukan untuk pasien 1.

Pengujian molekuler tidak secara universal tersedia, terutama di negara berkembang. Selain itu, panel pengujian yang tersedia berbeda dalam kepekaannya dan dalam jumlah gen yang diuji. Akhirnya, dokter sangat bervariasi dalam kenyamanan dan keterampilan mereka dalam menginterpretasikan tes genom kanker. 52 Pendidikan berkelanjutan penting, dan ahli patologi molekuler yang mengeluarkan laporan dapat membantu klinisi dengan interpretasi varian yang jelas dan terbaru. [19659130] Kesimpulan

Pengujian genetika molekuler dapat membantu dalam konfirmasi gangguan klonal pada pasien dengan cytopenia yang tidak dapat dijelaskan, dan hasil tes negatif juga dapat mempengaruhi penilaian diagnostik, karena nilai prediktif negatif yang tinggi dari hasil normal untuk gangguan seperti MDS. NGS results may also aid in selecting treatment or transplant decision making for MDS patients in selected circumstances. Increasingly, DNA sequencing is likely to be part of a multilevel assessment that also involves epigenetic sequencing, RNA sequencing to look for cryptic fusions, and other assessments that will ultimately improve diagnosis, prognosis, and treatment monitoring.

Acknowledgment

This work is supported by the Edward P. Evans Foundation.

Authorship

Contribution: D.P.S. wrote the paper.

Conflict-of-interest disclosure: D.P.S. serves on the data safety monitoring committee or does consulting related to clinical trials sponsored by: Celgene, H3 Biosciences, Janssen, Onconova, Otsuka, Acceleron.

Correspondence: David P. Steensma, Dana-Farber Cancer Institute, D2037, 450 Brookline Ave, Boston, MA 02215; e-mail: David_steensma{at}dfci.harvard.edu.

  • SubmittedJune 28, 2018.
  • AcceptedAugust 30, 2018.

Download Jurnal Disini

Tags: